Provogue (provogue.com) — Digital Brand Intelligence Report

Report generated: 2026-08-11. Primary store: https://www.provogue.com/ (Provogue / Provogue (India) Pvt Ltd). Competitive set taken from competitive-analysis.md in this workspace.

Scope note: Data sourced from public channels (Instagram, Facebook, YouTube, X/Twitter, LinkedIn, Pinterest, Trustpilot, Google Reviews) and public web search. Instagram and Facebook profiles are login-walled, so follower/engagement metrics for those two channels come from third-party aggregator snippets and search result excerpts, not direct inspection — confidence is labeled accordingly. TikTok is excluded per methodology (blocked in India). All figures are point-in-time snapshots.


1. Executive Summary

Provogue presents a split digital identity: a large legacy Facebook audience (276K likes) and a recognizable celebrity-led relaunch (Fardeen Khan, "OGs Ka Comeback," July 2026) sit on top of a thin, low-engagement social footprint on the channels that actually drive modern D2C discovery — Instagram (~29.5K) and YouTube (39 videos, recent ad films at ~239 views each). The single most important finding is a structural trust gap: Provogue has no first-party review presence anywhere — no Trustpilot profile on its own domain, no branded Google Business reviews, and no on-site ratings — while competitor complaint threads on consumer forums flag historic refund/delivery failures. Overall Digital Brand Health: 5.2/10. Of 8 channels attempted, 2 (Instagram, Facebook) were only partially observable due to login walls and 2 (Trustpilot, Google Reviews) had no usable brand-owned presence at all.


2. Channel Inventory

PlatformHandleFollowersVerifiedAccount AgePrimary UseActive
Instagram@provogue.official~29.5Kpre-2021Brand/lifestyleActive (partial — login walled)
Facebook/Provogue276,065 likeslegacy (~2010s)Community/heritageActive (partial — login walled)
YouTube@provogue.officialsubscribers not exposed~2020sAd films/productActive, low output
X / Twitter@Provogue_Indiaunavailable~2012Brand broadcastPresent, low signal
LinkedInprovogue-india-private-limited351B2B/hiringMinimal
Pinterestin.pinterest.com/provogueunavailableInspirationPresent, low signal
Trustpilot(provogue.com)none foundReviewsNot found on own domain
Google Reviews(provogue.com)none surfacedReviewsNot found (no Business profile)

Footer social links on provogue.com expose only Facebook, Instagram, and YouTube — LinkedIn, Pinterest, X, and both review platforms are absent from the site's own wiring.


3. Deep-Dive by Channel

Instagram — https://www.instagram.com/provogue.official/

Identity

  • Handle confirmed via footer link and third-party (Social Blade realtime: 29,545 followers, 266 following). Bio not directly inspectable (login wall).
  • Profile photo consistency vs. other channels: unverified (walled).

Audience

  • Followers ~29.5K (snapshot; trend unavailable without time-series). Following 266 — a normal brand ratio, not an authenticity red flag by itself.
  • Engagement rate: cannot be calculated directly (posts login-walled). No usable like/comment sample obtained.

Content Performance

  • Posting frequency / cadence: not inspectable. Content themes inferred from PR + YouTube: celebrity campaign (Fardeen Khan), luggage/product, lifestyle.
  • Story/Reel frequency, UGC signals: unverified.

Commerce Integration

  • Shop tab / product tags: unverified (walled). Bio link likely routes to store.

Customer Service

  • Comment responsiveness: not inspectable (login wall). No public evidence either way.

Brand Health Signals

  • Sentiment: no comment sample available. Marked Low confidence.

Facebook — https://www.facebook.com/Provogue

Identity

  • 276,065 likes · 295 talking about this. Bio: "We're all about contemporary style, cool designs and owning the vibe! Join the Provogue crew and stay fresh #ItsHappening."
  • This is the only channel with a numeric, publicly-exposed audience figure (via search excerpt); it reads as a legacy-accumulated following rather than an actively-engaged one (295 "talking about this" against 276K likes is a very low interaction ratio).

Audience

  • 276K likes, 295 talking-about-this (point-in-time). Low engagement-to-follower ratio.

Content Performance / Commerce / Service

  • Login-walled; post sample and responsiveness not inspectable. Presence inferred from likes count and bio only.

YouTube — https://www.youtube.com/@provogue.official

Identity

  • 39 videos. Bio: "Provogue is all about contemporary style, cool designs, and owning your vibe." Linked to Instagram + 1 more.
  • Subscriber count not exposed via rendered page or console (returns not-found).

Content Performance

  • Recent uploads are a 3-part celebrity ad-film series "PROVOGUE x FARDEEN KHAN — OGs ka Comeback" (59s / 36s / 39s), posted ~late July 2026.
  • View counts on these flagship ad films are very low (~239 views each within ~6 days) — a strong signal of low subscriber base and/or weak organic distribution despite professional production.
  • No Shorts cadence visible; catalog content thin (39 videos total).

Commerce Integration

  • Standard YouTube product/description links typical; not directly verified.

Brand Health

  • Limited sample; sentiment unverified.

X / Twitter — https://x.com/Provogue_India

  • Handle exists (legacy bio: "Provogue is one of the leading fashion brands of India, offering the best in lifestyle fashion"). Follower count unavailable from public snippet. Treated as a low-signal, largely dormant channel.

LinkedIn — https://in.linkedin.com/company/provogue-india-private-limited

  • 351 followers. Bio: "At Provogue, We redefine travel with a perfect blend of style, durability, and functionality." Minimal B2B/hiring signal; not a meaningful discovery channel for this brand.

Pinterest — https://in.pinterest.com/provogue/

  • Exists. Bio: "PROVOGUE | Provogue is a reflection of the attitude, belief, values and lifestyles of our customers." Follower count unavailable. Low-signal inspiration board.

Trustpilot & Google Reviews — Not Found

  • No Trustpilot profile for provogue.com was surfaced in search. The only Trustpilot hit was for www.rvogue.com (a divergent/typo domain, ~288 reviews) — not the official brand, so it is not counted as Provogue's presence.
  • No branded Google Business profile / reviews surfaced for Provogue luggage.
  • Third-party complaint visibility exists on consumercomplaints.in/provogue-india (historic refund/delivery complaints, 2014–2023) and aggregator mentions (MouthShut, AmbitionBox employee rating 3.6/5). These are not first-party review assets.

4. Cross-Channel Insights

Provogue's social architecture is legacy-Facebook-heavy and discovery-light. The brand clearly invested in a 2026 relaunch narrative — the Fardeen Khan "OGs ka Comeback" campaign is real, press-covered (Campaign India, AdGully, Bollywood Hungama, Impact), and professionally produced — but that investment is not converting into engaged audiences on the channels where its D2C competitors win: Instagram and YouTube show small/low-engagement communities relative to the spend behind the campaign. Commerce wiring is shallow (store-linked bios, minimal native shopping evidence), and the trust layer is effectively missing: no reviews on social, on-site, or review platforms. The brand tells a consistent "contemporary style / own your vibe" story across the channels that are open, but the story is delivered to audiences that are mostly legacy or tiny.


5. Strategic Review

5.1 Executive Scorecard

CategoryScoreConfidence
Brand Identity & Voice7/10Medium
Audience Quality5/10Medium-Low
Content Strategy6/10Medium
Content Quality6/10Low-Medium
Customer Journey Coverage5/10Medium
Trust & Reputation3/10Medium
Community Management4/10Low
Social Commerce Maturity5/10Low-Medium
Competitive Positioning4/10Medium
Digital Ecosystem Consistency6/10Medium
Operational Maturity5/10Low-Medium
AI Visibility6/10Low-Medium
Overall Digital Brand Health5.2/10weighted by confidence

Critical-floor caveat: Trust & Reputation scored 3/10 at Medium confidence. The 5.2/10 average understates the severity of this single category — a brand with no first-party review presence and visible complaint threads is exposed to a credibility crisis that the average does not surface. This is the report's primary risk flag, not a "mediocre-everywhere" 5.2.

5.2 Category-by-Category Assessment

1. Brand Identity & Voice Consistency — Score: 7/10 (Confidence: Medium) Strengths: Consistent "contemporary style / owning your vibe" voice across Facebook, YouTube, and Pinterest bios; clear youth/lifestyle positioning tied to the luggage pivot. Weaknesses: Instagram bio not verifiable (login wall); site footer wires only 3 of 6 channels, leaving the identity fragmented. Evidence: Matching bios on FB ("contemporary style, cool designs and owning the vibe"), YT ("contemporary style, cool designs, and owning your vibe"), Pinterest ("attitude, belief, values and lifestyles"). Business Impact: Positioning is coherent where visible, but the missing IG/LinkedIn/Pinterest/Review wiring means a new visitor rarely gets the full story, diluting brand recall versus competitors with tighter cross-channel presence.

2. Audience Quality — Score: 5/10 (Confidence: Medium-Low) Strengths: Facebook audience is large (276K); Instagram following (29.5K) is a real, non-trivial base. Weaknesses: Facebook engagement is disproportionately low (295 "talking about this" vs 276K likes); YouTube's flagship ad films drew ~239 views — suggestive of a small, weakly-activated audience on the discovery channels. Evidence: FB likes/talking-about ratio; YT "OGs ka Comeback" ad films ~239 views each; IG 266 following (normal brand ratio, not a fake-follower signal by itself). Business Impact: Reach exists on legacy Facebook but affinity/activation is weak on the channels that convert — meaning paid/earned campaign spend is landing on under-engaged audiences. Authenticity cannot be forensically confirmed from public data; this is directional only.

3. Content Strategy — Score: 6/10 (Confidence: Medium) Strengths: A genuine narrative pillar — heritage comeback ("OGs ka Comeback") bridging legacy and new luggage line — plus product and lifestyle content. Weaknesses: Pillar mix is promotional/brand-led with limited educational, UGC, or community content; Consideration-stage content (reviews, testimonials) is absent. Evidence: Fardeen Khan campaign (3 ad films, July 2026) plus product/lifestyle framing across YT and PR. Business Impact: The strategy generates awareness but does little to build the consideration and trust assets that shorten the luggage purchase journey; competitors with review/UGC engines convert mid-funnel more efficiently.

4. Content Quality — Score: 6/10 (Confidence: Low-Medium) Strengths: YouTube ad films are professionally produced (multi-cut celebrity spots with hooks and branded audio). Weaknesses: Cannot assess Instagram/Facebook craft (login-walled); no evidence of a consistent editing/CTA standard across channels. Evidence: 59s/36s/39s produced ad films on YouTube; IG/FB visual quality unverified. Business Impact: Production on the hero campaign is adequate, but unverified day-to-day content quality on the highest-traffic channels is a risk to perceived premium positioning.

5. Customer Journey Coverage — Score: 5/10 (Confidence: Medium) Strengths: Awareness is well-served (celebrity campaign, PR, YouTube). Conversion is wired (store-linked bios, Shopify store, YouTube product links). Weaknesses: Consideration and Retention/Advocacy are under-served — no reviews, no UGC program, no loyalty, no visible community content. Evidence: Campaign + PR for awareness; store links for conversion; absence of review/UGC/loyalty signals across all channels and the site (per competitive-analysis.md). Business Impact: The funnel is top-heavy: Provogue spends to create awareness but has almost no social asset that helps a shopper decide or return — the exact stages where luggage buyers need reassurance on durability and warranty.

6. Trust & Reputation — Score: 3/10 (Confidence: Medium) Strengths: Brand heritage (founded 1997) and a celebrity association lend some borrowed credibility. Weaknesses: No first-party review presence — no Trustpilot profile on provogue.com, no Google Business reviews, no on-site ratings. Third-party complaint threads (consumercomplaints.in) flag historic refund/delivery failures. Evidence: Absence of Trustpilot/Google Reviews for the brand domain; consumercomplaints.in/provogue-india complaint history; on-site review absence confirmed in competitive-analysis.md. Business Impact: This is the report's primary risk. In a category where buyers rely on durability/warranty proof, the absence of any review surface pushes decision-stage shoppers to competitors with 1,000s of marketplace/Amazon reviews (Mokobara 1,680+ Amazon reviews; Uppercase 1,680 Amazon reviews). It also leaves negative forum sentiment unanswered and uncontextualized.

7. Community Management — Score: 4/10 (Confidence: Low) Strengths: LinkedIn and (presumably) Facebook exist as response surfaces. Weaknesses: No inspectable comment responsiveness on IG/FB (walled); no concrete examples of replies to negative feedback found; complaint forums suggest slow/weak historical resolution. Evidence: Login-walled IG/FB comments; consumercomplaints.in threads indicating refund/delivery disputes. Business Impact: Without visible, warm public service recovery, existing complaints harden into reputation damage and prospective buyers see no proof of post-purchase care.

8. Social Commerce Maturity — Score: 5/10 (Confidence: Low-Medium) Strengths: Shopify store exists; YouTube carries product/description links; bio links route to the store. Weaknesses: No verified native shopping (IG/FB shop tabs unconfirmed; product-tagging unseen); cross-sell/bundle strategy not visible on social. Evidence: Store-linked bios, Shopify backend (per competitive-analysis.md), YT description links; IG/FB shop unverified. Business Impact: Social is used as a traffic referer rather than a storefront — leaving conversion friction (external link-out) on the table versus competitors with shoppable posts.

9. Competitive Positioning — Score: 4/10 (Confidence: Medium) Strengths: Facebook audience (276K) is competitive with legacy players; Instagram (29.5K) leads the smallest niche rivals (NORI ~337). Weaknesses: Trails the premium D2C disruptors decisively on the key discovery channel — Mokobara ~842K Instagram followers, EUME ~127K, vs Provogue ~29.5K. Samsonite India ~38K is comparable. Evidence: IG follower comparison — Provogue 29.5K, Mokobara 842K, EUME 127K, Samsonite India 38K, NORI 337; Facebook 276K legacy. Business Impact: On Instagram — the primary D2C discovery surface for luggage — Provogue is ~28× behind Mokobara and ~4× behind EUME in raw reach, ceding mindshare to better-socialized challengers despite comparable product and stronger heritage.

10. Digital Ecosystem Consistency — Score: 6/10 (Confidence: Medium) Strengths: Social voice and the site's luggage/lifestyle positioning are aligned; footer links to the three primary channels work. Weaknesses: Footer omits LinkedIn, Pinterest, X, and both review platforms; the site's own trust gap (no on-site reviews) mirrors the social trust gap — consistent, but consistently weak. Evidence: Footer exposes only FB/IG/YT; site review absence per competitive-analysis.md and prior CRO/site audits in this workspace. Business Impact: The ecosystem tells one coherent but under-built story; the missing links and missing reviews mean the site and social reinforce each other's gaps rather than compensating.

11. Operational Maturity — Score: 5/10 (Confidence: Low-Medium) Strengths: The Fardeen Khan campaign shows planned, coordinated push (multi-channel PR + YouTube series, July 2026). Weaknesses: YouTube output is thin (39 videos total); cadence on IG/FB unverifiable; no visible always-on content rhythm. Evidence: Coordinated campaign launch; low YT volume; sporadic historical posting implied. Business Impact: Campaign spikes exist but absence of a steady content calendar means momentum from the celebrity push will decay between campaigns.

12. AI Visibility — Score: 6/10 (Confidence: Low-Medium) Strengths: Strong entity recognition via PR (Campaign India, AdGully, Bollywood Hungama, Impact, TheGlitz) around the relaunch; a Wikipedia "Provogue" page exists for heritage. Weaknesses: Thin owned-review/forum discussion; entity signal is campaign-driven rather than evergreen. Evidence: Multiple July 2026 PR placements; Wikipedia heritage entry; limited Reddit/Quora/UGC discussion surfaced. Business Impact: Provogue is discoverable in AI-mediated news/search around its campaign, but lacks the durable, discussion-rich footprint (reviews, forums, UGC) that sustains off-campaign discovery.

5.3 Executive Synthesis

Provogue has bought awareness (a celebrity relaunch and a large legacy Facebook base) but has not built the trust and community infrastructure that converts awareness into durable D2C revenue. The brand's social presence is top-of-funnel heavy — strong on campaign storytelling, near-empty on Consideration (reviews/UGC) and Retention/Advocacy (loyalty, community) — and it is materially out-reached by better-socialized challengers like Mokobara (≈28× the Instagram following) on the exact channel where luggage shoppers discover brands. Combined with a total absence of first-party review presence, this creates a credibility gap that any competitor with a visible review engine (Mokobara, Uppercase, Nasher) can exploit at the decision stage, where Provogue is currently silent.

5.4 Prioritized Recommendations

  1. Stand up first-party reviews everywhere (highest impact).
    • Evidence: No Trustpilot/Google Reviews/on-site ratings; competitor complaint threads on consumer forums.
    • Action: Add on-site rated reviews (Judge.me/Yotpo) to PDPs (also recommended in competitive-analysis.md), claim/seed a Google Business profile, and open a Trustpilot profile for provogue.com.
    • Expected impact: Closes the decision-stage credibility gap and directly counters the 3/10 Trust score; lifts conversion where durability/warranty reassurance is decisive.
  1. Rebuild Instagram as the primary discovery channel.
    • Evidence: IG ~29.5K vs Mokobara ~842K; YouTube ad films at ~239 views show weak organic distribution.
    • Action: Shift creative budget from one-off ad films to a consistent Reels/UGC calendar (travel stories, unboxing, warranty/durability proof, customer features); collaborate with travel creators.
    • Expected impact: Narrows the ~28× reach gap with Mokobara and feeds the Consideration stage the brand currently lacks.
  1. Convert the celebrity campaign into always-on community, not a spike.
    • Evidence: Coordinated Fardeen Khan push (July 2026) but thin YT volume (39 videos) and unverified cadence.
    • Action: Commit to a steady posting calendar and visible comment/Customer-service recovery on IG/FB; publicly answer the existing consumer-complaint threads.
    • Expected impact: Prevents campaign momentum decay and begins repairing the community-management gap (currently 4/10).
  1. Wire the full ecosystem and add native shopping.
    • Evidence: Footer exposes only FB/IG/YT; shoppable posts unverified.
    • Action: Add LinkedIn/Pinterest/X and review-platform links to the footer; enable Instagram/Facebook Shops and product tagging tied to the Shopify catalog.
    • Expected impact: Reduces conversion friction (native checkout) and makes the brand feel consistently present across the journey.
  1. Lean into the differentiators competitors can't copy.
    • Evidence: Heritage (1997), personalised/co-created printed luggage, 3–5 yr warranty, celebrity relaunch — unique vs pure-play D2C.
    • Action: Make personalisation, warranty, and "OG comeback" heritage the recurring content pillars and review-prompt themes.
    • Expected impact: Builds a defensible brand narrative that distances Provogue from discount-driven D2C rivals and supports premium positioning.

6. Competitive Benchmarking

Instagram follower comparison (primary D2C discovery channel), with available cross-channel signals:

PlatformProvogueMokobaraSamsonite IndiaEUMENORI (IN)SafariSkybags/VIPNasher MilesUppercaseAssembly
Instagram@provogue.official (~29.5K)@mokobara (~842K)@samsoniteindia (~38K)@eumeworld (~127K)@noriindia (~337)not surfacednot surfacednot surfacednot surfacednot surfaced
Facebook/Provogue (276K likes)/SamsoniteIndia (1.88M likes)legacy largelegacy large
YouTube@provogue.official (39 videos, subs N/E)
LinkedIn35113,478
Trustpilotnone (own domain)marketplace/Amazon reviewsmarketplacemarketplacemarketplacemarketplace1,680 Amazonsome Amazon/Flipkart

Notes: Safari, Skybags/VIP, Nasher Miles, Uppercase, and Assembly Instagram follower counts were not surfaced in public search snippets and are marked not surfaced rather than estimated. NORI Instagram figure is the India handle @noriindia (337) and is low-confidence given brand-handle ambiguity. "N/E" = not exposed.

MetricProvogueMokobaraEUMESamsonite India
Instagram followers~29.5K~842K~127K~38K
Facebook likes276K1.88M
Review presenceNone (own domain)Strong (Amazon/loyalty)GrowingStrong (marketplace)
Platform coverage (of 8 surveyed)6/8 present, 2 absent (TP/GR)n/a in this sweepn/an/a

Key Competitive Insights:

  • Provogue leads: only on Facebook legacy scale among the surveyed set it beats (276K vs unmeasured rivals) and marginally on Instagram vs the tiniest niche player (NORI).
  • Provogue trails: decisively on Instagram reach vs Mokobara (~28×) and EUME (~4×); on review/social-proof infrastructure vs every funded D2C rival; on platform breadth of verified social proof.
  • Clearest gap opportunity: Instagram discovery + first-party reviews. Mokobara's dominance is built on exactly these two assets; Provogue's heritage and personalisation story is a stronger differentiator than Mokobara's, yet is underwater on reach and trust.
  • Distinctive competitor strategy worth noting: Mokobara pairs a Shopify loyalty program (3× repeat-sales lift, per Shopify case study) with owned retail and a large Instagram community — a repeat-purchase engine Provogue entirely lacks.

7. Data Sources & Confidence

Data PointSource(s)Confidence
Instagram ~29.5K followersSocial Blade realtime snippet (provogue.official)Medium (third-party, not direct)
Facebook 276,065 likes / 295 talking-aboutSearch result excerpt (facebook.com/Provogue/about)Medium
YouTube 39 videos, bio, ad-film views (~239)Direct browser inspection of @provogue.officialHigh (direct) for video count/views; subscriber count N/E
LinkedIn 351 followersSearch result excerptHigh
X/Twitter @Provogue_India existsSearch result excerptMedium (count unavailable)
Pinterest profile existsSearch result excerptMedium (count unavailable)
No Trustpilot/Google Reviews (own domain)Search sweep (trustpilot.com/review/provogue.com, Google)Medium-High (absence confirmed across queries)
Consumer complaint historyconsumercomplaints.in/provogue-indiaMedium (historic, limited sample)
Competitor IG/FB countsPublic search snippets (Social Blade, Instastatistics, LinkedIn)Medium (third-party)
On-site review absencecompetitive-analysis.md (this workspace)High (prior task finding)
Follower demographics / reach / impressionsNot available from public sourcesN/A (omitted)

Methodology Notes: Follower counts are point-in-time snapshots; no time-series was available, so growth trends are not asserted. Engagement rates could not be computed for Instagram/Facebook (login-walled) or YouTube (subscriber/like counts not exposed) — those categories are scored on directional signals, not calculated ER. Sentiment is based on limited public samples (complaint-forum threads, PR tone), not a statistically valid comment scrape. Demographics, reach, and impressions are structurally unavailable from public browsing and are omitted rather than inferred. TikTok excluded per methodology (blocked in India).


8. Appendix A: Raw Structured Data

<details> <summary>JSON</summary>

{
  "brandSlug": "provogue",
  "brandName": "Provogue (India) Pvt Ltd",
  "researchDate": "2026-08-11",
  "channelsAnalyzed": ["instagram", "facebook", "youtube", "x", "linkedin", "pinterest", "trustpilot", "google_reviews"],
  "data": {
    "brandIdentity": {
      "instagram": {"handle": "@provogue.official", "followers": 29545, "following": 266, "bio": "not inspectable (login wall)", "confidence": "medium"},
      "facebook": {"handle": "/Provogue", "likes": 276065, "talkingAbout": 295, "bio": "We're all about contemporary style, cool designs and owning the vibe! Join the Provogue crew and stay fresh #ItsHappening", "confidence": "medium"},
      "youtube": {"handle": "@provogue.official", "videos": 39, "subscribers": "not exposed", "bio": "Provogue is all about contemporary style, cool designs, and owning your vibe.", "confidence": "high"},
      "x": {"handle": "@Provogue_India", "followers": "unavailable", "bio": "Provogue is one of the leading fashion brands of India, offering the best in lifestyle fashion.", "confidence": "medium"},
      "linkedin": {"handle": "provogue-india-private-limited", "followers": 351, "confidence": "high"},
      "pinterest": {"handle": "in.pinterest.com/provogue", "followers": "unavailable", "bio": "PROVOGUE | Provogue is a reflection of the attitude, belief, values and lifestyles of our customers.", "confidence": "medium"},
      "trustpilot": {"domain": "provogue.com", "present": false, "confidence": "medium-high"},
      "googleReviews": {"domain": "provogue.com", "present": false, "confidence": "medium-high"}
    },
    "audienceDepth": {
      "instagram": {"followers": 29545, "following": 266},
      "facebook": {"likes": 276065, "talkingAbout": 295},
      "youtube": {"videos": 39, "recentAdFilmViews": 239}
    },
    "contentPerformance": {
      "youtube": {"recentSeries": "PROVOGUE x FARDEEN KHAN - OGs ka Comeback (3 ad films, ~Jul 2026)", "viewsPerFilm": 239, "cadence": "thin (39 videos total)"}
    },
    "commerceIntegration": {"storeLinkedBios": true, "shopifyStore": true, "nativeShoppingVerified": false, "confidence": "low-medium"},
    "customerService": {"igFbResponsiveness": "not inspectable (login wall)", "complaintForums": "consumercomplaints.in/provogue-india (historic refund/delivery)", "confidence": "low"},
    "brandHealth": {"trustpilot": false, "googleReviews": false, "onSiteReviews": false, "complaintClusters": "refund/delivery (historic)"},
    "partnershipsInfluencers": {"brandAmbassador": "Fardeen Khan (relaunch, 'OGs Ka Comeback', Jul 2026)", "confidence": "high"},
    "hiringCulture": {"linkedinFollowers": 351, "employeeRating": "AmbitionBox 3.6/5 (20+ reviews)"},
    "socialSEOAuthority": {"prPlacements": ["Campaign India", "AdGully", "Bollywood Hungama", "Impact", "TheGlitz"], "wikipedia": "Provogue (heritage fashion)"},
    "competitiveBenchmark": {
      "instagramFollowers": {
        "provogue": 29500,
        "mokobara": 842000,
        "samsoniteIndia": 38000,
        "eume": 127000,
        "noriIN": 337
      },
      "facebookLikes": {"provogue": 276065, "samsoniteIndia": 1881636}
    }
  },
  "strategicReview": {
    "brandIdentity": {"score": 7, "confidence": "medium"},
    "audienceQuality": {"score": 5, "confidence": "medium-low"},
    "contentStrategy": {"score": 6, "confidence": "medium"},
    "contentQuality": {"score": 6, "confidence": "low-medium"},
    "customerJourneyCoverage": {"score": 5, "confidence": "medium"},
    "trustReputation": {"score": 3, "confidence": "medium"},
    "communityManagement": {"score": 4, "confidence": "low"},
    "socialCommerce": {"score": 5, "confidence": "low-medium"},
    "competitivePositioning": {"score": 4, "confidence": "medium"},
    "digitalEcosystem": {"score": 6, "confidence": "medium"},
    "operationalMaturity": {"score": 5, "confidence": "low-medium"},
    "aiVisibility": {"score": 6, "confidence": "low-medium"},
    "overallDigitalBrandHealth": 5.2
  },
  "dataConfidence": {"instagram": "medium (third-party)", "facebook": "medium", "youtube": "high (direct)", "trustpilotGoogle": "medium-high (absence confirmed)", "competitorCounts": "medium (third-party)"},
  "methodologyNotes": "Point-in-time snapshots; login-walled IG/FB prevented direct ER computation; engagement scored directionally. TikTok excluded (blocked in India). Demographics/reach/impressions omitted as structurally unavailable."
}

</details>


9. Appendix B: Research Log

  • Channels attempted: Instagram, Facebook, YouTube, X/Twitter, LinkedIn, Pinterest, Trustpilot, Google Reviews (8).
  • Methods: Web search snippets (third-party aggregator excerpts) for walled/metric-only channels; direct browser navigation + console for YouTube (video count, recent ad-film views); terminal curl of provogue.com homepage footer for canonical social links; web search sweep for review platforms and competitor handles.
  • Blockers: Instagram and Facebook returned login walls (no follower/engagement/post-sample extraction possible); YouTube subscriber count not exposed via rendered page or console; Trustpilot and Google Reviews have no brand-owned presence on provogue.com (confirmed across multiple queries); Safari/Skybags/VIP/Nasher/Uppercase/Assembly Instagram counts not surfaced in public snippets (marked not surfaced, not estimated).
  • Escalation applied: Where direct extraction failed (IG/FB), the methodology's fallback chain (browser navigate → snapshot → search-proxy snippets) was followed; metrics were recorded as unavailable or third-party-sourced with confidence labels rather than fabricated.